PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C002723P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 174aa    MW: 19878.2 Da    PI: 9.5089
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C002723P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.68.9e-201157349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +++   rqvtfskRrng++KKA  L +LC+ e+a+++fs+ gk + +
  MELO3C002723P1 11 VKDRGSRQVTFSKRRNGLFKKATDLATLCGLEIAIVVFSPGGKAFSF 57
                    677889************************************98766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.67E-28173IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.058161IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-31160IPR002100Transcription factor, MADS-box
CDDcd002654.65E-31273No hitNo description
PRINTSPR004044.3E-20323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-221257IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004044.3E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MGRRKIEMKM VKDRGSRQVT FSKRRNGLFK KATDLATLCG LEIAIVVFSP GGKAFSFGNP  60
NVEEVVDRYL SCEWKVNRNT AVRERGMLEK ENEELLDLVK QLQMEKKKGE VMEKEMKSRG  120
ELMKIEDLDL NELLKLKESL EKLRKNVKIE ESELEASFSL LLLANEKPVR GDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-15169169Myocyte-specific enhancer factor 2B
1tqe_R4e-15169169Myocyte-specific enhancer factor 2B
1tqe_Q4e-15169169Myocyte-specific enhancer factor 2B
1tqe_P4e-15169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444113.11e-119PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0A0M0453e-68A0A0A0M045_CUCSA; Uncharacterized protein
STRINGPOPTR_0004s13600.11e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-31AGAMOUS-like 29